PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004282.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 571aa    MW: 63743.9 Da    PI: 6.4798
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004282.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.88.9e-092733072155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 + +yps+ e+  LA+++gL+++q+ +WF N+R ++
  Do004282.1 273 RWPYPSEMEKIALAESTGLEQKQINNWFINQRKRH 307
                 569*****************************885 PP

2Homeobox26.21.4e-084995342055
                 HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +k +yps++++  LA+++gL+ +q+ +WF N+R ++
  Do004282.1 499 YKWPYPSETQKVALAESTGLDLKQINNWFINQRKRH 534
                 5679*****************************885 PP

3ELK31.25e-11227248122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK++Ll+KYsg+Lg+L++E++
  Do004282.1 227 ELKRHLLKKYSGRLGNLRKELC 248
                 9*******************97 PP

4ELK36.41.2e-12454475122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELKh+Ll+KYsgyL+sLkqE+s
  Do004282.1 454 ELKHHLLKKYSGYLSSLKQELS 475
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.4E-872112IPR005540KNOX1
PfamPF037909.3E-1074105IPR005540KNOX1
SMARTSM012562.2E-20120180IPR005541KNOX2
PfamPF037911.6E-13126178IPR005541KNOX2
PfamPF037892.3E-8227248IPR005539ELK domain
SMARTSM011881.2E-5227248IPR005539ELK domain
PROSITE profilePS5121311.121227247IPR005539ELK domain
PROSITE profilePS5007112.73247310IPR001356Homeobox domain
SMARTSM003896.7E-13249314IPR001356Homeobox domain
SuperFamilySSF466891.37E-19249325IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-27252312IPR009057Homeodomain-like
CDDcd000864.69E-12259311No hitNo description
PfamPF059208.3E-16267306IPR008422Homeobox KN domain
PROSITE patternPS000270285308IPR017970Homeobox, conserved site
SMARTSM012550.62312358IPR005540KNOX1
SMARTSM012569.6E-28365416IPR005541KNOX2
PfamPF037912.5E-22371414IPR005541KNOX2
SMARTSM01188570374394IPR005539ELK domain
PfamPF037891.4E-9454475IPR005539ELK domain
PROSITE profilePS5121311.331454474IPR005539ELK domain
SMARTSM011884.9E-7454475IPR005539ELK domain
PROSITE profilePS5007112.487474537IPR001356Homeobox domain
SuperFamilySSF466893.38E-19475550IPR009057Homeodomain-like
SMARTSM003894.2E-12476541IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-27479539IPR009057Homeodomain-like
CDDcd000866.34E-11486538No hitNo description
PfamPF059201.2E-15494533IPR008422Homeobox KN domain
PROSITE patternPS000270512535IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MEDLSDLGGR GHLGAAARPA LGPPLTSSSR VSVEVYTVPS STAGGGARAQ VVAPVGHASS  60
GSGHGGCVGD LDPVKAKIVS HPRYHGLLAA FLDCHKAQAA EEIAAAARER EAWQRAAAGD  120
AHTARPDPEL DQFMVEYQQT LLDESYSELL VAWKEELSRP LREAKEFLTT VESQLNSIAC  180
TGPPLGALIS ADGKIGPEDL SDDDQEEGSG MEAEEALGID PRSDDKELKR HLLKKYSGRL  240
GNLRKELCKK RKKGKLPKEA RQKLLSWWEL HYRWPYPSEM EKIALAESTG LEQKQINNWF  300
INQRKRHWKP SEEMQFAVMD GFHPPPNAAT ALYVDARLVG APPEVSARLT AMTQELEARQ  360
RAALGGLGAA TEPELDQFME AYHEMLVKFR EELTRPLQEA MEFMRRVETQ LNSLSISGRS  420
LRNILSSGSS EEDQEGSGGE TELPEVDAHG VDQELKHHLL KKYSGYLSSL KQELSKKKKK  480
GKLPKEARQQ LLSWWDLHYK WPYPSETQKV ALAESTGLDL KQINNWFINQ RKRHWKPSEE  540
MHHLMMDGYH TTGAFYMDGH FINDGGLYRL G
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1242251LRKELCKKRK
2248252KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3174200.0DQ317420.1 Setaria italica KNOTTED1 homeodomain protein (KN1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981910.11e-179PREDICTED: homeobox protein knotted-1-like 7
SwissprotP243451e-155KN1_MAIZE; Homeotic protein knotted-1
TrEMBLK4ABD61e-178K4ABD6_SETIT; Uncharacterized protein
STRINGSi036193m1e-177(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98863145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.12e-74KNOTTED-like from Arabidopsis thaliana